Protein Info for mRNA_4544 in Rhodosporidium toruloides IFO0880

Name: 12912
Annotation: K01251 E3.3.1.1, ahcY adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00936: adenosylhomocysteinase
  • amino acids 3 to 435 (433 residues), 646.5 bits, E=8.2e-199
• PF05221: AdoHcyase
  • amino acids 3 to 139 (137 residues), 248.2 bits, E=2.2e-77
  • amino acids 139 to 442 (304 residues), 200.5 bits, E=7.5e-63
• PF00670: AdoHcyase_NAD
  • amino acids 189 to 363 (175 residues), 260.7 bits, E=1.2e-81
• PF02826: 2-Hacid_dh_C
  • amino acids 208 to 298 (91 residues), 26.7 bits, E=6.6e-10
• PF07991: IlvN
  • amino acids 209 to 271 (63 residues), 21.4 bits, E=3.3e-08

Best Hits

Swiss-Prot: 76% identical to SAHH_DICDI: Adenosylhomocysteinase (sahA) from Dictyostelium discoideum

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 76% identity to ddi:DDB_G0267418)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

• S-adenosyl-L-methionine salvage II (3/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Protein Sequence (443 amino acids)

>mRNA_4544 K01251 E3.3.1.1, ahcY adenosylhomocysteinase (Rhodosporidium toruloides IFO0880)
MVYKVADISLAAWGRKEIVLAENEMPGLMYLREKYGPSQPLKGARIAGCLHMTIQTAVLI
ETLTALGAQVAWSSCNIFSTQDQAAAAIAATGVPVFAWKGETEEEYLWCIDQTLKAFPNG
EPLNMILDDGGDLTALVHDKYPELLAGINGVSEETTTGVHHLYKLHKEGKLKIPAINVND
AVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGYGDVGKGCAESLRSYGARCIIT
EIDPINALQAAMAGFEVTTMEEAAPQGNVFVTTTGCRDILRAEHFEVMPEDAIVCNIGEQ
RCCRAFKTPGCHFDCEIDVAWIKANAKEHVNIKPQVDRYTMNSGRHIILLAEGRLVNLGC
ATGHPSWVMSCSFTNQVLAQIALWTDIKSYPLGVHILPKALDEEVARAHLQSLNVKLTKM
TKVQADYLGLPVEGPYKPEHYRY