Protein Info for mRNA_4559 in Rhodosporidium toruloides IFO0880

Name: 12927
Annotation: HMMPfam-PAP2 superfamily-PF01569,SMART-Acid phosphatase homologues-SM00014,SUPERFAMILY--SSF48317

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 46 to 74 (29 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 248 to 264 (17 residues), see Phobius details amino acids 273 to 289 (17 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details PF14378: PAP2_3" amino acids 140 to 309 (170 residues), 86.7 bits, see alignment E=1.8e-28 PF01569: PAP2" amino acids 221 to 312 (92 residues), 35.5 bits, see alignment E=8.4e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>mRNA_4559 HMMPfam-PAP2 superfamily-PF01569,SMART-Acid phosphatase homologues-SM00014,SUPERFAMILY--SSF48317 (Rhodosporidium toruloides IFO0880)
MRLYLPSAIRDPLLGAISRLEISFDVQVSLKRVRRYGWKWSRDWEYAVDLALALLSLTVM
AQPVFFKLFLIVAYTTALLIPFTSQFFLPATPIFSWLLLFYSSQFIPKSYRPHIWVSVLP
TLESILYGANISDLLTRWTNPALDFLAWIPYGVIHFVAPFVVAALLWVFSPPGAVKFWAA
AFGYMNLAGVIIQIVFPCAPPWYELREGLVPANYNMRGSPGGLARIDALFGGHGYETTFS
GAPVPFGAFPSLHAGCSTMEALFLSHFFPKWRPFYWLYVFVLYWSTMYLTHHYLIDLVAG
GSLTCAFFYYYLSKMPDELRHPTTPVAPYRARASSSAIPLDEESGLPRTFTHTAAGKASN
GHANGYGGWESDDAGASEEDDLAEEARLFGGEAGAAPGRDSFDVPLKGDMGAARTPRRD