Protein Info for mRNA_4567 in Rhodosporidium toruloides IFO0880

Name: 12935
Annotation: K10743 RNASEH2A ribonuclease H2 subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR00729: ribonuclease HII" amino acids 78 to 300 (223 residues), 168.5 bits, see alignment E=1e-53 PF01351: RNase_HII" amino acids 78 to 297 (220 residues), 158.1 bits, see alignment E=1.4e-50

Best Hits

Predicted SEED Role

"Ribonuclease HII (EC 3.1.26.4)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA replication, archaeal or Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>mRNA_4567 K10743 RNASEH2A ribonuclease H2 subunit A (Rhodosporidium toruloides IFO0880)
MAGRKRAASPSPSRSPSPGAEKQPRFHFPSVRRNEPLIDSYTYHSVDTEREQADEQSGAD
KDAKEAEEKREVEGEWMLGVDEAGRGPALGPQVYGIAFCQLSYESTLKEMGFADSKTLTD
PLREELFKDILEHKDDVKYAVTVMSPNDISMGMLRKVPYNLNAQSHDVTINLIREVVERG
YKIKQCFVDTVGPAADYQSKLSSFFPTINFTVTSKADALFPIVSAASIVAKVTRDRILEE
WCFAEPGVGEKGEGEEGEAVRVFGSGYPSDPKTVAWLQDNFNPIFGFPNVARFSWAPVKN
ALLKKGAASKWDDEPASIQKYITGKPAGPEQAPLWKDFNLVSVGEF