Protein Info for mRNA_4573 in Rhodosporidium toruloides IFO0880

Name: 12941
Annotation: K03142 TFIIH2, GTF2H2, SSL1 transcription initiation factor TFIIH subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13519: VWA_2
  • amino acids 128 to 237 (110 residues), 45.9 bits, E=1.2e-15
• PF04056: Ssl1
  • amino acids 130 to 311 (182 residues), 220 bits, E=4e-69
• TIGR00622: transcription factor ssl1
  • amino acids 357 to 470 (114 residues), 105.2 bits, E=1.6e-34
• PF07975: C1_4
  • amino acids 413 to 469 (57 residues), 40 bits, 5.7e-14

Best Hits

KEGG orthology group: K03142, transcription initiation factor TFIIH subunit 2 (inferred from 46% identity to lbc:LACBIDRAFT_249203)

Predicted SEED Role

No annotation

Protein Sequence (471 amino acids)

>mRNA_4573 K03142 TFIIH2, GTF2H2, SSL1 transcription initiation factor TFIIH subunit 2 (Rhodosporidium toruloides IFO0880)
MSRKRMERDFIAADDEPVSGEELGEGDESDLENDYSSDEGLGRMRGSRGARGGAGVNGKG
VSTRSASSRDKGKGKAWEGQFERTWDMVQEDERGTLEGAVSDMLLTSKSRRVLRDTASIQ
RGIIRHVYLVIDLSSAMLVRDFKATWLDLTLQYAQDFVNEFFQQNPIGQMAIMITRDGLA
ERLTPLSGNPADHLKVLQNKKKLEARGSPSLQNVLQLAKTGLSHLPPHGSREVIVILGSL
TTTDPTNIHQTIAETEAERIRVNIIGLSADMKICRDICEQTNGVYRVARDDLAFRDLLFE
FVLPPPTFAPSKSHVLGGPSPAAPTSSADLMQMGFPGLISSTFPGVCSCHGKLKTTGYSC
PRCKARLCDVPTECRVCGLTVVNAPQLARSYRHLFPVTNYERVMQTSDDNSPSCFSCAFP
FTTLAHAVQSAQLGYLSPLGRYRCPKCMHHFCLECDKLVHDALGFCPGCCE