Protein Info for mRNA_4579 in Rhodosporidium toruloides IFO0880

Name: 12947
Annotation: KOG1399 Flavin-containing monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 245 to 271 (27 residues), see Phobius details PF13738: Pyr_redox_3" amino acids 31 to 231 (201 residues), 40.9 bits, see alignment E=5.6e-14 PF00743: FMO-like" amino acids 31 to 238 (208 residues), 54.2 bits, see alignment E=3.2e-18 PF13450: NAD_binding_8" amino acids 32 to 86 (55 residues), 35.1 bits, see alignment 4.4e-12 PF13434: K_oxygenase" amino acids 89 to 229 (141 residues), 42.9 bits, see alignment E=1.3e-14

Best Hits

Predicted SEED Role

"Cyclohexanone monooxygenase (EC 1.14.13.22)" (EC 1.14.13.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>mRNA_4579 KOG1399 Flavin-containing monooxygenase (Rhodosporidium toruloides IFO0880)
MSHSEKHQLMPKPKPFTQHSAPDTKDHYTCIVMGAGLSGMASAIQLRRKMGIDDVLVYEK
TSDVGGTWNVNRYPGAACDIPFTFYSFSFYPAYHASSQWAGQKEILEYLHEVQTKFKLNN
IVFRTAVETARFSRDDGLWHLSVKNEETGEVRNRTCNILISCLGGLTIPNDPPFKREDFT
GEVFHSARWREDVSLKGKDVVVVGNGCSAAQIVPEIVHEAATVTQIARSRQSIIRRIKAP
DNAFLHFLMRWIPGFGFIVRSLVFFVMESFFKITDIKKGERERKKTVKEINEYIEETAPK
KYWDVLRPDFDVAAKRRVFDSGYYESLNAPNMELIADDVVTTVKGDKVYTKNGRVCRADI
IVLATGFKVRDFLFPLKIYNDKGQSLQDRLNANGIKTYQSTLVAEFPNFFWIMGPNSATG
HSSVLFTSESQLALTFHLIRPIVEKLRKVQLLKPAPFVEVTTEAEDRFYDAVRKEMKKKV
WEKDGGVSWYVDKATGLCSTLYPWSQVHFWRSCTFPNYRDFKWTGAERPAAWRSYLGWY