Protein Info for mRNA_4593 in Rhodosporidium toruloides IFO0880

Name: 12961
Annotation: K05286 PIGB phosphatidylinositol glycan, class B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 98 to 116 (19 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 329 to 352 (24 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details PF03901: Glyco_transf_22" amino acids 5 to 427 (423 residues), 235.2 bits, see alignment E=8.4e-74

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (602 amino acids)

>mRNA_4593 K05286 PIGB phosphatidylinositol glycan, class B (Rhodosporidium toruloides IFO0880)
MPHPFLLALPLRLLSALLSRAFFQPDEYYQSLEPAYSLVFGPDAGAYETWEWRVRLESEG
GWWEGGKGGIRSPLGVVVSAGVYWVLKRAGWDHGEWMVLAPRLAQACIAASMDVAFVRLS
SRILGPAYTNAALLTTLTSFFHFFTASRTLSNSTETALTAWALRYWPWDATSESNLPLSL
GFAAIATVLRPSNAVVWVFLGGQLMWESSGRRRWYIIRVAALIGLLASLFSFTLDTAFYR
TPTFTPLRFLHTNVLRSISLFYGSNSSHFYLSQGLPILLLTQLPFFLHGLSARRWEGVRN
PRALRALRWMLAGTIGTYSLLSHKEWRFIHPLLPVMHLFVALSLVKLSLASASPSSPSAP
SRWTRTIRVRPTHATILLAALIPATYLTTLHGLGQTRVSSYLRSLPLPRSVGWLMPCHSA
GWGAHLHTREWGRRLRDVEEEGSGKGEKEGGKGEGQGMWMVTCEPPLDGQDPSTYQDETD
HFYACPCTFLSTRFPSVVDPSFPPTPSPSLRAAGEKQRYTWPAHLVLFSSLLSHPCPSSP
SSPYPNLEALLRDKGYEREWSAWNTLWGWHEDWRRRGRVEVWSWRASNTVTENGRDWRGA
EG