Protein Info for mRNA_4625 in Rhodosporidium toruloides IFO0880

Name: 12993
Annotation: K09660 MPDU1 mannose-P-dolichol utilization defect 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 58 to 78 (21 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 170 to 182 (13 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details PF04193: PQ-loop" amino acids 55 to 112 (58 residues), 48.8 bits, see alignment E=2.5e-17 amino acids 171 to 221 (51 residues), 45.6 bits, see alignment 2.4e-16

Best Hits

KEGG orthology group: K09660, mannose-P-dolichol utilization defect 1 (inferred from 40% identity to nfi:NFIA_107810)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>mRNA_4625 K09660 MPDU1 mannose-P-dolichol utilization defect 1 (Rhodosporidium toruloides IFO0880)
MAAFLSDKLQPLSAVTHNLPPFIRDPAVALLGQECYTTLVWNLDLTSEYCLKLGLSKGLG
LAMVAGGAILKLPQIITVVRRGSARGLSLSSYVLDTVATGITVAYNVRNGFPYSTWGEMA
FLLAQNAVLIVLITSYSARPTLPRLAPLVVLFSKLAYALSNTSLVPSSTLSFLQTLTIPI
SLSSKVPQILSNFRNRSTGQLSAFLVFNSLAGCLARVFTTRTETNDPLLFWGFLLGALLN
GVIAIQMLVYPSDARSASKRDIERPVELLGEKVKTATGVAQHDIASAAHLAQHDIASAAH
LAQEKVAAYSTPVKQAVGAGPKRTASPASSGSARRYVRKME