Protein Info for mRNA_4633 in Rhodosporidium toruloides IFO0880

Name: 13001
Annotation: K00521 E1.16.1.7 ferric-chelate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 213 to 237 (25 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 306 to 331 (26 residues), see Phobius details amino acids 457 to 475 (19 residues), see Phobius details PF01794: Ferric_reduct" amino acids 174 to 294 (121 residues), 62.3 bits, see alignment E=1e-20 PF08022: FAD_binding_8" amino acids 359 to 446 (88 residues), 37.6 bits, see alignment E=4.3e-13 PF08030: NAD_binding_6" amino acids 454 to 616 (163 residues), 57.7 bits, see alignment E=3.2e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (637 amino acids)

>mRNA_4633 K00521 E1.16.1.7 ferric-chelate reductase (Rhodosporidium toruloides IFO0880)
MSPLHPSTFLAAAAPTTPGLSHVKQLAASTFVRTHETVRQQKADRSFALAYQYIIVAIIA
VLTIRNVARVIARRNRAWRLVLQKLNSLQMEKLGEQKEGYEPLGHRATWSAKMDAIVFLP
LRSRWACGLENPLQVFLVLASIALNVGFVLAITLEYNGPQNSTWNTIHVVALRCGWMSMA
QLPAVIAMTGRNSLVRFLTGIDEQHLRFCHKLLAAWMALLGVVHTVDATCAQLVWFGGNG
VGSLWLHNYLGQTGIAMILGLILLCVFSLRPIRMRFYETFLVAHVTGVILVLVGIIYHVP
SLRVWLYVPLGFWIFERVMRLVQTCSLSLLLQLKFRLPLVKASATLIEGAVVLRVPFKGE
WQAGQHCFLHFLDPSFASTPTVWFQSHPFSIANVPTCTVAYDNGHHDMLFVMRTRKGMTK
VLADRLAKSPTGMADLWCTVEGPYGGATDTEQFHEILLVAGGAGISHVMSMLADILYKAR
NSYSRATRVRVIWTVQNVEQSVWTLRELLNSAKTAYEAGVELQVELYVTRGMQAPSPQTV
DLLYKELPQPPRPTLEQRRASVASTNSWHESPIVDALTILPGRPRIDHIVPRFVANAQGK
TLVVTCGPTAMAQAVRWEVTKLFSAYPVSLEVALFEC