Protein Info for mRNA_4641 in Rhodosporidium toruloides IFO0880

Name: 13009
Annotation: KOG1161 Protein involved in vacuolar polyphosphate accumulation, contains SPX domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 829 transmembrane" amino acids 736 to 755 (20 residues), see Phobius details amino acids 762 to 783 (22 residues), see Phobius details amino acids 803 to 823 (21 residues), see Phobius details PF03105: SPX" amino acids 153 to 187 (35 residues), 31.6 bits, see alignment (E = 2.7e-11) PF09359: VTC" amino acids 234 to 516 (283 residues), 302.5 bits, see alignment E=4.4e-94 PF02656: DUF202" amino acids 726 to 791 (66 residues), 47.7 bits, see alignment E=2.7e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (829 amino acids)

>mRNA_4641 KOG1161 Protein involved in vacuolar polyphosphate accumulation, contains SPX domain (Rhodosporidium toruloides IFO0880)
MKFGATIKDALYQDWQASYIDYGALKRFIKERQAKHQWDDADEAEFVQALAAELDKVVNF
QERKIEELTKTIADYEDVVNNLIRLSAEERSAGASRATRTQQEGLGPVVDAHREEEEGML
SDDTLSDTSDDALEDRYVELEEDLANVIADVHDLGHFSHLNYTGFVKIVKKHDKRTGFKL
KGHFMKDFLEKRPFYRENYDGLILQLSRLYNMVRTRGHPIVGDSSAGGNQSAFVRQTTKY
WVHPDNFVQLKLVILKHLPILGTSVVSRLLACFFNPEKEFEPDDAAITSIYLDAPDLDLY
MGRLEKTEGAEAIRLRWYGGMGVKQIFVERKTHREDWTGEKSVKARFPIAEHLVNDYLAG
KYTMDETFEALRKKGKKTDKEVDSMIKLAREVQAAVKHKKLGPVMRTFYNRTAFQLPGDA
RVRISFDTQLSLIREDNWDGVTRSGNNWRRTDIGIDWPFPQLPDSDKELFPYGVLEVKLQ
TQMGQEPPEWVRELVSSHLVEAVPKFSKFIHGCATLLPNRVDLVPFWLPQMETDIRKPAT
QKAQIQRPPTSHSNTNSGTPSETRSTDLAQYTEPVSDDEEDEGNRHIGATADEAGWADLD
PQAAAEAKAYREAQSKVAKGPGGRSEQSHLVAAPPKPPKSNEFFPKLTPANLSKLLDSRY
ELERDRGLNQQGPSTEAREEAEATGAAEATGNPSGLSLVPGRVEYVSSFRAGQGKKIAVP
VRVEPKVFYANERTTLAWIEFSVIISAIGIGILSFSDPHDDIALAAAASFTTVALLAILY
TAWTYWWRVRMIRARQAVQYHDYIGPTALCGILLVAVIVNFSLRLKQGI