Protein Info for mRNA_4662 in Rhodosporidium toruloides IFO0880

Name: 13030
Annotation: K20352 TMED10, ERV25 p24 family protein delta-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 198 to 217 (20 residues), see Phobius details PF01105: EMP24_GP25L" amino acids 33 to 222 (190 residues), 122.7 bits, see alignment E=9.1e-40

Best Hits

Swiss-Prot: 38% identical to TMEDA_SCHPO: Endoplasmic reticulum vesicle protein 25 (erv25) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 57% identity to scm:SCHCODRAFT_61127)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>mRNA_4662 K20352 TMED10, ERV25 p24 family protein delta-1 (Rhodosporidium toruloides IFO0880)
MARTRHTPGRTSLLAAALALLVLPSLVSAVKFSLTAHHNPKPKCLWNYAMSDTLVVISVS
SPVTGNDLQRLDMEVVDGSSSRNTYQAKRGLKGETRMAITTHADADLGVCFRNVLDPSVP
EHQANKYERLIDLDVDIGADAVDYNAIAKQESLSGLEVEMRKLEGVVKEIVDELNYLKRR
EMRMRDTNESTNARVKNFFYLTFSTLILLGVWQVIHLRSYFKKKYLID