Protein Info for mRNA_4680 in Rhodosporidium toruloides IFO0880

Name: 13048
Annotation: K01067 E3.1.2.1, ACH1 acetyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF03061: 4HBT" amino acids 10 to 83 (74 residues), 42.7 bits, see alignment E=2.9e-15 amino acids 317 to 390 (74 residues), 36.2 bits, see alignment E=3.2e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>mRNA_4680 K01067 E3.1.2.1, ACH1 acetyl-CoA hydrolase (Rhodosporidium toruloides IFO0880)
MQSPAECDEHGRVYGGELLKLIDVSAGLVAAKHAGGPCLTISADRVIFLEEIRVGDVISL
SSAVNRAWGSSMEIGVRVMRQSRTDPLGPETYCSHAYLTFVAKPSPPPPPGSLLSLTDTL
GLTRPPKPRRAQLPELKPSSLLEQKRYLLAGRRRAHRIKQAKENDRRNAAFREQIYEVER
ESRQGAAAAVDEQFADRAALLGQLQVELLSEMFMRGESDVRVEGDEIVGEIEGFVEPVRV
KKALVDRAVLEKGHGGWHKISLATDEDVDRAAGHTTRVSLDPHVQAAASIVSSVSFEATL
SMGLWIVRPQHCNSKSILFGGTLMRWVEEVSTIAARRVYPTASWSSAAIDSLTFKTAVQP
GEVVYVRAAVIKVFDSSLEVAAVVTCEDRNSPSPKIREVSESFFTLVAMDPSSGRPLKGV
LRHVELPPSGPVTELASLAQKRRDDRLLDKRILQRVYA