Protein Info for mRNA_4698 in Rhodosporidium toruloides IFO0880

Name: 13066
Annotation: K12193 VPS24, CHMP3 charged multivesicular body protein 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF03357: Snf7" amino acids 22 to 194 (173 residues), 115 bits, see alignment E=1.5e-37

Best Hits

Swiss-Prot: 44% identical to CHMP3_HUMAN: Charged multivesicular body protein 3 (CHMP3) from Homo sapiens

KEGG orthology group: K12193, charged multivesicular body protein 3 (inferred from 62% identity to scm:SCHCODRAFT_47850)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>mRNA_4698 K12193 VPS24, CHMP3 charged multivesicular body protein 3 (Rhodosporidium toruloides IFO0880)
MAMQSINRFLWGPTPQEKVRKWQGQLKKEQRMLDREIHSLDLASNKVKAEVKKLAQKGDT
KNAKLLAREVVRSNRQKQRMLTSKAQLNSINMQLGHQLAMVKVTGTLQASTEIMRASNSL
IKLPQLSGTMREMSAEMMKAGIMTEMMDDTMETFDEADEELEEEAQEEVDKVLWQITDGK
LGQASGKVGELPQTTGPTPAEIERDEEIERAIQGLLSS