Protein Info for mRNA_4707 in Rhodosporidium toruloides IFO0880

Name: 13075
Annotation: KOG4431 Uncharacterized protein, induced by hypoxia

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details PF04588: HIG_1_N" amino acids 42 to 93 (52 residues), 64.7 bits, see alignment E=3.6e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>mRNA_4707 KOG4431 Uncharacterized protein, induced by hypoxia  (Rhodosporidium toruloides IFO0880)
MPAAYTPDPVVNPEDLAAAAPVPSKSRENPGTWAKFSKKFKEEPLVPIGCIATVAALLAA
SSALQKGNRTRFNQFLRYRVAAQGFTVIAALGGSLYYQSQRKAERKAEAMARQQEMEALG
AGAPAAAPPAAAAAAGPQV