Protein Info for mRNA_4719 in Rhodosporidium toruloides IFO0880

Name: 13087
Annotation: K18693 DPP1 diacylglycerol diphosphate phosphatase / phosphatidate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details PF01569: PAP2" amino acids 109 to 259 (151 residues), 96.1 bits, see alignment E=7.7e-32

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>mRNA_4719 K18693 DPP1 diacylglycerol diphosphate phosphatase / phosphatidate phosphatase (Rhodosporidium toruloides IFO0880)
MDFVHRLIHGPERRKQPVDKSRRLKLLASYLPDWILTIILVAIIGYFTDYAGYKREFSLT
DTSIQHTFATKERISFGECIVYAGVIPAVVIILVSLIWRRSFWDMHNGLLGLLLSVSLTT
VFTQVVKVTVGRPRPDLIDRCQPVSGASNHAVYGLATVALCTVQTGHIIDDGFKSFPSGH
SSFAWAGLGYFALYLAGKMHLFDQRGHTIKSWIAITPPIGATLIAVSRTMDYRHHATDVI
AGGILGALIAIMTYHLYYPSLFSPQCHLPFSPRIPAIATSERLDSDAEEPGTAPRPRQGN
HPDAPILPLHGRNSFGSDGSPTGGNGIPLEANPHEVGGRRGEAAGTVKPYSGYY