Protein Info for mRNA_4735 in Rhodosporidium toruloides IFO0880

Name: 13103
Annotation: K03654 recQ ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 803 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 143 to 163 (21 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 102 to 443 (342 residues), 337.6 bits, see alignment E=6e-105 PF00270: DEAD" amino acids 114 to 274 (161 residues), 68.6 bits, see alignment E=6.2e-23 PF00271: Helicase_C" amino acids 317 to 423 (107 residues), 51.8 bits, see alignment E=9.7e-18

Best Hits

KEGG orthology group: None (inferred from 48% identity to scm:SCHCODRAFT_255426)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (803 amino acids)

>mRNA_4735 K03654 recQ ATP-dependent DNA helicase RecQ (Rhodosporidium toruloides IFO0880)
MPRLVLSPARSRSFWPSLSFSVPTRLFSALADLPPRRLPWRAPGPGRGIQAIQALHSCSP
KPSTQSAPSASSPPHSASFKSKHAQAHRTTRRPAMEVAYAQLKRYWGFPSFRGVQAEVIQ
RLVVESENALCIMPTGGGKSLVFQVPALCFDGLTLVISPLIALSKDQVDNLKKRGVPAAA
LDSSLTTEESSEVRKQLREGTLKILYVAPERLNNEMFVSMISEQKISLLAVDESHCVSEW
GPSFRAEYLKVSRFAKEIAAERVLCLTATATPSVITDICDSTNGFDIDREKGVFSTGTFR
PNLSISIKPCANFKAKFAVLVPALKSRGDGAAIVYVTTQKQAEEVAQELHDLHGIEARPY
HAGLKADDRKTIQYWFIGGNGVVVATIAFGMGIDKANIRMVAHFQLPKTLENYSQEIGRA
GRDGLPSLCLMVPSASDMPILESFARANTPSLRSIRTWLDAFFISPLDDDGTISADHYKM
SNAFDIGRNTLSLLFTILELQYGLIRATTPFYSTYTIKPLENNPSAFPNILNDRSPEAAA
LQKHWKQWRIWHTIDVVGTAEAEGIERSKLVRQISRWEMNGWCEVKVAGVRMRYNIEKPL
PELDEDIEELANAIFKQLHEREEADVKRLRTVAEFVKGGQCYAHLLACYFGDDKAVPEKG
CGICSFCKTRQAIPFQPKYDTAFSEKQVRFVLGVCGVRDDPRFLARLAFGVSSPRSTQLG
LSKHEIFGCCETADFNKLLERFEAECEEQGYRNRAVLAPPKANARSKEGEADGKEASGAK
KAPAKRAASGGAKAGGAAKKAKK