Protein Info for mRNA_4775 in Rhodosporidium toruloides IFO0880

Name: 13143
Annotation: K01724 PCBD, phhB 4a-hydroxytetrahydrobiopterin dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01329: Pterin_4a
  • amino acids 21 to 108 (88 residues), 99.3 bits, E=5.7e-33

Best Hits

Swiss-Prot: 49% identical to PHS_RHIL3: Putative pterin-4-alpha-carbinolamine dehydratase (RL4526) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 49% identity to rlg:Rleg_4051)

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

• tetrahydropteridine recycling (1/2 steps found)
• L-phenylalanine degradation V (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Protein Sequence (117 amino acids)

>mRNA_4775 K01724 PCBD, phhB 4a-hydroxytetrahydrobiopterin dehydratase (Rhodosporidium toruloides IFO0880)
MATTSNASLRRQAASTASLTALTERGWQLSFAASTGSATQKLSREYTFKDFSEAWGFMSR
VALAAEKLNHHPEWTNVYNRVSIALTTHDEGNQLTALDVKLAERIEAIAGQAGGGET