Protein Info for mRNA_4814 in Rhodosporidium toruloides IFO0880

Name: 13182
Annotation: HMMPfam-SnoaL-like domain-PF13577,SUPERFAMILY--SSF54427

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF13577: SnoaL_4" amino acids 29 to 143 (115 residues), 36.9 bits, see alignment E=1.9e-13

Best Hits

Swiss-Prot: 47% identical to PEP2_NECH7: Pea pathogenicity protein 2 (PEP2) from Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI)

KEGG orthology group: None (inferred from 42% identity to aor:AOR_1_702034)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>mRNA_4814 HMMPfam-SnoaL-like domain-PF13577,SUPERFAMILY--SSF54427 (Rhodosporidium toruloides IFO0880)
MPLPPGAEPPLPPASLSTSLNYSASDPTTLLDRMAIRELMEGFPAHRDACEWRKMRALFA
EEDAYVFTTWSGGVPIDRFIEISEAGFAKGVKIAHRVNGGTVDVAISGPAAGKRGLGKLK
ATITQRFTMPTETEGETCEVDVEADCRLCFFVEKKANGDWKNHFFKGFYEKDRAIPVDPR
RIPHFDDEKLASFPEGYRYLAYGQSAAYKIKLDLPQSRGEEHDKFYESFIHWLEGASIET
MKQELGV