Protein Info for mRNA_4822 in Rhodosporidium toruloides IFO0880

Name: 13190
Annotation: K13800 CMPK1, UMPK UMP-CMP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13238: AAA_18
  • amino acids 30 to 196 (167 residues), 40.5 bits, E=8.1e-14
• PF00406: ADK
  • amino acids 32 to 117 (86 residues), 63.2 bits, E=6.3e-21
  • amino acids 140 to 220 (81 residues), 64.4 bits, E=2.6e-21
• PF13207: AAA_17
  • amino acids 33 to 199 (167 residues), 91.7 bits, E=1.2e-29

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.3

Use Curated BLAST to search for 2.7.4.3

Protein Sequence (248 amino acids)

>mRNA_4822 K13800 CMPK1, UMPK UMP-CMP kinase (Rhodosporidium toruloides IFO0880)
MSVAAAELGTTATTSATSSPAFDPKEVTVIFVLGGPGAGKGTQCARLVQHHGFVHLSARH
SNHFRLSSLHPAGDLLRAEQQREGSQFGAMIKEYITEGKIVPMEVTIKLLENAMRAAMSS
EAGEAKEAGANGGVKGIPARRFLIDGFPRQMDQAVKFDETVCPSSLVLFLVCPEPILLER
LLERGKTSGRDDDNAESIKKRFQTFVNTSMPVVDYYRKQAKVVDIDSSKSIEEVYADIEK
GIAPVLRA