Protein Info for mRNA_4838 in Rhodosporidium toruloides IFO0880

Name: 13206
Annotation: K00326 E1.6.2.2 cytochrome-b5 reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details PF00970: FAD_binding_6" amino acids 50 to 146 (97 residues), 107.7 bits, see alignment E=5e-35 PF00175: NAD_binding_1" amino acids 156 to 263 (108 residues), 116.8 bits, see alignment E=1.1e-37

Best Hits

Swiss-Prot: 58% identical to NCB5R_CRYNJ: NADH-cytochrome b5 reductase 1 (CBR1) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: K00326, cytochrome-b5 reductase [EC: 1.6.2.2] (inferred from 58% identity to cnb:CNBM0240)

MetaCyc: 47% identical to NADH-cytochrome b5 reductase (Saccharomyces cerevisiae S288C)
Cytochrome-b5 reductase. [EC: 1.6.2.2]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>mRNA_4838 K00326 E1.6.2.2 cytochrome-b5 reductase (Rhodosporidium toruloides IFO0880)
MALFPVWKDLDQQHQVILAAAVGVVLAALAFLQLQPKRKPALDPTQWKRFKLIDKIAISP
NTAIYRFALPKGQILGLPIGQHVSVSATIEGKLVQRSYTPTSSDDDVGFFDLLIKSYPTG
NISKHFSTLKIGDYVDVKGPKGQMRYSPDFAKNIGMIAGGTGITPMLQIIRAAMKNPLDR
TNIALIYANVNESDILLKAELDELAAKYPDQFKVYYVLNNPPEGWKGGVGFVSKDMIEEH
LPAHAEDHKALLCGPPPMINAMKKHLDDLKWPAPRTISKMQDAVFCF