Protein Info for mRNA_4846 in Rhodosporidium toruloides IFO0880

Name: 13214
Annotation: K03943 NDUFV2 NADH dehydrogenase (ubiquinone) flavoprotein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01958: NADH-quinone oxidoreductase, E subunit
  • amino acids 52 to 199 (148 residues), 177.8 bits, E=7.1e-57
• PF01257: 2Fe-2S_thioredx
  • amino acids 52 to 199 (148 residues), 202.3 bits, E=1.6e-64

Best Hits

Swiss-Prot: 60% identical to NDUV2_NEUCR: NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial (nuo-24) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K03943, NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC: 1.6.5.3 1.6.99.3] (inferred from 66% identity to uma:UM00634.1)

MetaCyc: 58% identical to NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (Homo sapiens)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (2/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3, 1.6.99.3

Use Curated BLAST to search for 1.6.5.3 or 1.6.99.3

Protein Sequence (241 amino acids)

>mRNA_4846 K03943 NDUFV2 NADH dehydrogenase (ubiquinone) flavoprotein 2 (Rhodosporidium toruloides IFO0880)
MKHAARLFSRQARQFSSTARAGSDALMVHRNSSYNNPNIPFKLNAENQKIAQQIIAKYPP
QYKKAAVIPLLEVAQKQNKNWTSISVMNHVAEILEMPPMRVYEVASFYTMFNREPVGEHF
VQICTTTPCMLGGCGSDKIVEAIENHLGISVGETSKDNKFTLLEVECLGACSNAPMVQIN
DKFYEDLTPESMVNILEDLAAGKEPKTGPHSARKGSEPNGPLTALNDIPKDPKAHFLAEW
R