Protein Info for mRNA_4863 in Rhodosporidium toruloides IFO0880

Name: 13231
Annotation: KOG0645 WD40 repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF00400: WD40" amino acids 6 to 41 (36 residues), 22.6 bits, see alignment 1.5e-08 amino acids 71 to 103 (33 residues), 21 bits, see alignment (E = 5.1e-08) amino acids 126 to 159 (34 residues), 27.9 bits, see alignment 3.3e-10 amino acids 168 to 204 (37 residues), 23.1 bits, see alignment 1e-08 amino acids 213 to 250 (38 residues), 31.2 bits, see alignment 2.8e-11

Best Hits

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>mRNA_4863 KOG0645 WD40 repeat protein (Rhodosporidium toruloides IFO0880)
MTRVRLLDTLEGHQDRAWHVAWNPAQPTLASCSTDKSVRLYSYAPASTATAEADSTTAGP
SSYRFSLNSTIPTSHSRTVRSLSFSPTGATLATASFDSTVGIWCEVSEAGLDDGEGAKGD
EWEAVDPLEGHENECKSVAWSSDGRLLASCSRDKSVWVWEAVGPADFECLAVLMEHSQDV
KCVTWHPTDELLASASYDDTIKLYAADPYDDEWTCIHTLTSHTATVWTLSFSPCGRYLAS
AGDDLVIKLWERVSLLEDDEKRSEVLGEVGEAKREEGGRMGPWSSGGVRIGMKERWTWVE
RGQIEGAHERTVYAVDWARGGVSEEEGGLGRIVTAGGDGRINVFQMTKPSSPDAPPTHTL
LETIEDAHSVSDVNHVAWCHISPTSAAAKLRALEGGEADPADEEEDEQGAKEDARWERAG
DMFASAGDDGLVKVWIVDPEEAQA