Protein Info for mRNA_4870 in Rhodosporidium toruloides IFO0880

Name: 13238
Annotation: KOG2533 Permease of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 42 to 59 (18 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details amino acids 402 to 422 (21 residues), see Phobius details amino acids 434 to 455 (22 residues), see Phobius details PF07690: MFS_1" amino acids 51 to 417 (367 residues), 134.9 bits, see alignment E=1.7e-43

Best Hits

KEGG orthology group: None (inferred from 52% identity to cci:CC1G_10601)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (492 amino acids)

>mRNA_4870 KOG2533 Permease of the major facilitator superfamily (Rhodosporidium toruloides IFO0880)
MSSIDTEKRQSPPASHKGRQQASSHGFTAADWELDKAAVRRLDWTVLPLCAIVYLLNFLD
RSNIGNAKVAGLAKDLHLTPHQYLVALTCTYVLYIVFELPSNLLLKKVGAHFMLPGMVTL
WGICCCMTGFVQNYGGLVAARLILGMLEGGVFPGLVLYLSSFYRRHELQTRISLFFSAAS
LSGAFSGLLAAAIINLDGKGGQEGWRWIFFLEGGFTALFGILLFFLLPGSPSTSRFLTAE
HKAHIERRLQLDSPAGTTDFEETFSWREVNKAATSPHVVFLLVALFGNGMTLYAFSYFTP
TIVATFKYTTVQTQLLTVPPFVCAFLMTMFNAWWSDRYGRRGLCVILMSLLSLVGYIMFL
KSLSTAVRYVSLFLAITGVYSTAPALVTWLPNNSAGHYRKATAVALGFIMTNSGGIASTW
LFPTNEGPRYYKATSVLISMTLVVALFASLNLLYLRRENAKKALLREANGGEVDAESWRE
KGDRHEHFVYSM