Protein Info for mRNA_4880 in Rhodosporidium toruloides IFO0880

Name: 13248
Annotation: K17795 TIM17 mitochondrial import inner membrane translocase subunit TIM17

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02466: Tim17
  • amino acids 15 to 122 (108 residues), 111.1 bits, E=1.9e-36

Best Hits

Swiss-Prot: 63% identical to TIM17_SCHPO: Mitochondrial import inner membrane translocase subunit tim17 (tim17) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 78% identity to cnb:CNBH2480)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Protein Sequence (165 amino acids)

>mRNA_4880 K17795 TIM17 mitochondrial import inner membrane translocase subunit TIM17 (Rhodosporidium toruloides IFO0880)
MSRHDHTRDPCPWVILNDFGGAFAMGAVGGTVWHGIKGARNSPRGDRLLGSLSAIKARAP
VVGGNFGVWGGLFSSFDCAVKGYRQKEDPWNAIISGFLTGGTLAVRSGPKGMLGSAIGCG
ILLGVFEGVGVLVGRLFAESNKPISPLLPEQSAPPPGQTPQLVGA