Protein Info for mRNA_4894 in Rhodosporidium toruloides IFO0880

Name: 13262
Annotation: K11187 PRDX5 peroxiredoxin 5, atypical 2-Cys peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF08534: Redoxin" amino acids 5 to 167 (163 residues), 96.4 bits, see alignment E=1.3e-31 PF00578: AhpC-TSA" amino acids 34 to 143 (110 residues), 28.7 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 47% identical to MALF3_MALFU: Putative peroxiredoxin (Fragment) from Malassezia furfur

KEGG orthology group: K14171, alkyl hydroperoxide reductase 1 [EC: 1.11.1.15] (inferred from 50% identity to scm:SCHCODRAFT_67750)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>mRNA_4894 K11187 PRDX5 peroxiredoxin 5, atypical 2-Cys peroxiredoxin (Rhodosporidium toruloides IFO0880)
MTIEVGQTIPDAELGYVPYTDELEDPSVCGLPSKIHTHKDWKGKKVVIFGIPGSFTKTCS
ENHLPPYVTSYDQFKAKGVDAIYCIATNDMFVQSAFGRVHKTGDKVICISDASMSFLRPA
GLTQDLSHVGFGERAKRFALVVDDLKVTYVGEETGPGVGPSGAEAVLAKL