Protein Info for mRNA_4897 in Rhodosporidium toruloides IFO0880

Name: 13265
Annotation: K01759 GLO1, gloA lactoylglutathione lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00068: lactoylglutathione lyase
  • amino acids 1 to 142 (142 residues), 130.2 bits, E=2.1e-42
• PF00903: Glyoxalase
  • amino acids 3 to 138 (136 residues), 64.1 bits, E=7.6e-22

Best Hits

Swiss-Prot: 47% identical to LGUL_PSEAE: Lactoylglutathione lyase (gloA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 69% identity to cnb:CNBH3440)

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

• methylglyoxal degradation VIII (3/3 steps found)
• methylglyoxal degradation I (2/3 steps found)
• superpathway of methylglyoxal degradation (4/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.5

Protein Sequence (150 amino acids)

>mRNA_4897 K01759 GLO1, gloA lactoylglutathione lyase (Rhodosporidium toruloides IFO0880)
MFRIKDPKISLDFYTRILGMELVHESPGGDFTNYFLAFPEEGKENMSKEEKSDRKFQREG
ILELCHNYGTENDADFKYANGNEEPGRGFGHIAISVDDVEAECKRLDGLGVQFKKRPEEG
RMKHIAFVYDPDRYWIEIVPNGGKKGEKGM