Protein Info for mRNA_4913 in Rhodosporidium toruloides IFO0880

Name: 13281
Annotation: HMMPfam-Spermine/spermidine synthase-PF01564,ProSiteProfiles-Polyamine biosynthesis (PABS) domain profile.-PS51006,SUPERFAMILY--SSF53335

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 57 to 74 (18 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details PF01564: Spermine_synth" amino acids 354 to 462 (109 residues), 27.3 bits, see alignment E=1.2e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (613 amino acids)

>mRNA_4913 HMMPfam-Spermine/spermidine synthase-PF01564,ProSiteProfiles-Polyamine biosynthesis (PABS) domain profile.-PS51006,SUPERFAMILY--SSF53335 (Rhodosporidium toruloides IFO0880)
MARVKPRKAAQQPAHVTRHPSLPLRLVAAFVSILPLLFPSAATDVLHPLFSSAPVHAAQP
TAIVYGTLAALFLAQRCLRGQGNRRLGWRACWFGVGAWKVLSEALVRLGGERLQGLGLSR
GILAGRFLVEGVPTLLLWSWLWDSFDCKETIVFLPHGFLPFAYIASLLLPRLASTSFTRP
ECYTLQLHGIVLCLVAIFASRTYSPPQLRRHHAASTFFSQASTFSRTLVLAPVLALAHAV
ALTTSHCPTSTSQLPPGVLASRRSVTGWITVGEHVVPSPDGSNERDLTLRYLRADHSLLG
GLWVGPSRDMLKMQFGGEPTEEEVVKRAESIYSTFILQEAVRLVKAPQDVPRQTPEQGLI
IGLGAGLSARALARHGVNLTLVEIDPAVHEFAERYFGVNEVKWGEVVLKDAVEWVDAQAK
ETSPSAFDYIVHDVFTGGAVPATLFTSTFLTQLKSLLHHSGSLALNFAGTLSSNSSRSIL
STLLSVFPHCRAFEDVPHTASGPAESTSDDTFRNMVILCSKEWYAPVGLRNPVKGDFLDY
PSPMIRRSVFASFRQHEIDLARFKPAPDDHGVGTWLLRDKNDVRRVEAAQLDEVGMHWDA
MEKVLPPEVWARW