Protein Info for mRNA_4920 in Rhodosporidium toruloides IFO0880

Name: 13288
Annotation: K01807 rpiA ribose 5-phosphate isomerase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 283 to 301 (19 residues), see Phobius details TIGR00021: ribose 5-phosphate isomerase A" amino acids 84 to 307 (224 residues), 228.7 bits, see alignment E=2.8e-72 PF06026: Rib_5-P_isom_A" amino acids 131 to 306 (176 residues), 203.9 bits, see alignment E=7.3e-65

Best Hits

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>mRNA_4920 K01807 rpiA ribose 5-phosphate isomerase A (Rhodosporidium toruloides IFO0880)
MSSQLRPLAPLAENPKLKSGPGSSNSTAPGQNSRRASHSSSGRPDPLGTEVHLSASRIGP
GVIPTGRMDVVPHEELSPEEKAKRLAAYAAVDEHVKDFHKVLGIGSGSTVPYVVERLCQP
PHCYANSDRWYVPTGFQSKELIVKAGLNLGDVDQFPTIDVTIDGADEVDDELNAIKGGGA
CQLREKVLAEAATHFIIVADSRKDSHVLGQTWKQGVPIEVAPFAWAKVFVNLQKMGCEKP
TLRMGKMKAGPVVTDNGNFVIDAVFSEPYMRDPAELLHRIKMLTGVLEVGLFVGMAEAAY
FGYPDGTVMARWQDGRRERVDATKGLEIAESGQRV