Protein Info for mRNA_4920 in Rhodosporidium toruloides IFO0880

Name: 13288
Annotation: K01807 rpiA ribose 5-phosphate isomerase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 84 to 307 (224 residues), 228.7 bits, E=2.8e-72
• PF06026: Rib_5-P_isom_A
  • amino acids 131 to 306 (176 residues), 203.9 bits, E=7.3e-65

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• Bifidobacterium shunt (14/15 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• Rubisco shunt (8/10 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Protein Sequence (335 amino acids)

>mRNA_4920 K01807 rpiA ribose 5-phosphate isomerase A (Rhodosporidium toruloides IFO0880)
MSSQLRPLAPLAENPKLKSGPGSSNSTAPGQNSRRASHSSSGRPDPLGTEVHLSASRIGP
GVIPTGRMDVVPHEELSPEEKAKRLAAYAAVDEHVKDFHKVLGIGSGSTVPYVVERLCQP
PHCYANSDRWYVPTGFQSKELIVKAGLNLGDVDQFPTIDVTIDGADEVDDELNAIKGGGA
CQLREKVLAEAATHFIIVADSRKDSHVLGQTWKQGVPIEVAPFAWAKVFVNLQKMGCEKP
TLRMGKMKAGPVVTDNGNFVIDAVFSEPYMRDPAELLHRIKMLTGVLEVGLFVGMAEAAY
FGYPDGTVMARWQDGRRERVDATKGLEIAESGQRV