Protein Info for mRNA_4928 in Rhodosporidium toruloides IFO0880

Name: 13296
Annotation: HMMPfam-Transient receptor potential (TRP) ion channel-PF06011,HMMPfam-ML-like domain-PF14558

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 851 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 177 to 202 (26 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 414 to 442 (29 residues), see Phobius details amino acids 498 to 519 (22 residues), see Phobius details amino acids 525 to 551 (27 residues), see Phobius details amino acids 651 to 671 (21 residues), see Phobius details amino acids 677 to 698 (22 residues), see Phobius details amino acids 710 to 729 (20 residues), see Phobius details amino acids 739 to 771 (33 residues), see Phobius details PF14558: TRP_N" amino acids 31 to 170 (140 residues), 79.5 bits, see alignment E=3.3e-26 PF06011: TRP" amino acids 176 to 558 (383 residues), 123.7 bits, see alignment E=8.9e-40 amino acids 649 to 779 (131 residues), 81.6 bits, see alignment E=5.1e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (851 amino acids)

>mRNA_4928 HMMPfam-Transient receptor potential (TRP) ion channel-PF06011,HMMPfam-ML-like domain-PF14558 (Rhodosporidium toruloides IFO0880)
MRLARSVAGAALALVVQSLAVSAQKRFCTSTSAVSYCSTSRAIEVKKFLLEYEPNQGPAG
TISFDISAASVESNLNANLQLGLVAYGINAINTTIQLCDILGGVLCPLPQYDFVGSATIP
LPTSLAGNIDIPGAAYWIPDLEATAYVRLLRVSDGSEAACLRVDLANGKTTRWASVSWAL
GGLAIGCVLLSALWFLVGTLVYPAASYTSTTSPTDPNAAWASLGRRKERLFLLMSILQFV
ATTGLLSINYPIIYEAFTSNFAWCLGLIRETPVVNAIDSLRARTGGNLTQLAGRSGLVGG
TEALKSIYSRSSVAYPSAGEIATSLLEEIGHTLSPKSASTSSLARRALSLLSSSSSTAHL
ARRQFGNPMSGIPSTNPSQAVAVPDVQETNTLTAVHYGIPHFLVNLDISPFDGFMLVFIN
FLFLCAMAIALAILGGAVWALVRLVQRRTRSRLAARGGYGGEEAKVGYEDKGAATGGRFR
ALRRRTSGTFTTLLRASTLRLLLIAWYPLLVFTFFQWTLGSSDSYAPIVLSVFTSVLTTL
ALLILAIRFFFLARRALRPRLTSVEDNAMAYDEPEVLASPFRPAPAAPPVTPNPNPKRAL
RKAERRDVETYSVGQFLAHGLAPYSPFWNSYKVRSRRATAQKRNWWKGRGWWFGLVELLL
VPLVTALFVGFAHRSGWTQTVALVTIQGLVFLATCIWTPYEDKTLNATRILWAICRVVIA
GALIAFNPSIGLNEIVRVAIGAVLLVIEAVLVVLFFVLLVIDFVQLCIFAVRGVKDRRRH
RGLGSDGSTTINPALPPMEERMAARDGSIPDHEGLGRPHTTHSGSTLANFDSSAGHPVDG
AAPPVGKTITP