Protein Info for mRNA_4929 in Rhodosporidium toruloides IFO0880

Name: 13297
Annotation: K01956 carA, CPA1 carbamoyl-phosphate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01368: carbamoyl-phosphate synthase, small subunit
  • amino acids 39 to 411 (373 residues), 388.6 bits, E=1.3e-120
• PF00988: CPSase_sm_chain
  • amino acids 39 to 178 (140 residues), 146.4 bits, E=6.4e-47
• PF00117: GATase
  • amino acids 224 to 409 (186 residues), 131.1 bits, E=6.8e-42
• PF07722: Peptidase_C26
  • amino acids 280 to 393 (114 residues), 28.8 bits, E=1.5e-10

Best Hits

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 76% identity to cci:CC1G_01969)

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• UMP biosynthesis II (6/6 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• urea cycle (5/5 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-arginine biosynthesis IV (archaea) (6/9 steps found)
• L-glutamate and L-glutamine biosynthesis (3/6 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Protein Sequence (441 amino acids)

>mRNA_4929 K01956 carA, CPA1 carbamoyl-phosphate synthase small subunit (Rhodosporidium toruloides IFO0880)
MLSLLRPSLALKRVPLATRSLATVVQPKSTNAFNPNLPATLHLKTGESFTGRSFGAPTSR
YGESVFSTSITSYTESMTDPSYRSQFLVFTTPLIGNYGVPDNFDPRNHVKNGPPVMLESN
GIQCAGVVVADVAERYSHYQAVESLHEWCDRHGVPGITGVDTRAITTLLRTNGSTLSKLA
VGDGHDVRPAASEYWDPAKENLVDQVSTREIYTLNPDGDVKIALLDFGAKANILRSLTNR
GAAVTVFPWNYDFNKVRDQFDGLFLSNGPGDPKHCMEAALNVRKTINEWDKPVFGICMGH
QIIGLAAGLEAYRMRFGNRGHNQPVLALASSGNIKAGRVYVTSQNHQYALELVDPFPKGW
QPFFINANDASVEGIMSTPESGKRVWGVQFHPESAGGPLDTQLMFGDFLASCRAGKHAGA
DLPVGGFSAAKFSAKDLEAGL