Protein Info for mRNA_4947 in Rhodosporidium toruloides IFO0880

Name: 13315
Annotation: K12584 DCPS, DCS m7GpppX diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05652: DcpS
  • amino acids 18 to 124 (107 residues), 77.9 bits, E=1e-25
• PF11969: DcpS_C
  • amino acids 153 to 264 (112 residues), 102.4 bits, E=2.2e-33

Best Hits

KEGG orthology group: K12584, scavenger mRNA-decapping enzyme DcpS [EC: 3.-.-.-] (inferred from 47% identity to ppl:POSPLDRAFT_93518)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.-

Protein Sequence (328 amino acids)

>mRNA_4947 K12584 DCPS, DCS m7GpppX diphosphatase (Rhodosporidium toruloides IFO0880)
MAPAASSSAPSFSSADALLSSFRFERVLSEDPRALLVYLLGTAVPEGQSERAPCILKLEK
TPYAPDEAPSLATPGAWSKLQTVTCNDIYSTSLAWFAPGRTTADVQILSICPATEKHVKK
YSMQVSRLVRETPELYETVVKPYMDSLSPSTISWVYNILDGTAEAENVLYRDDDPETGFV
LTPDLKWDQKTLSALYLLVLTQDRTIRSLRNLRTRHLPLLRKIRQECERVAMERYGIEKG
ELRFFVHYQPTYYHFHVHIVHLSYLSFSGITVGQAHLLDDLIDSLSLEVEASNSGGPAPL
QSWFERRTFTYSLGVEHPLYALLKEKGA