Protein Info for mRNA_4994 in Rhodosporidium toruloides IFO0880

Name: 13362
Annotation: K09568 FKBP1 FK506-binding protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF00254: FKBP_C" amino acids 14 to 106 (93 residues), 112.8 bits, see alignment E=3.9e-37

Best Hits

Swiss-Prot: 76% identical to FKBP1_RHIO9: FK506-binding protein 1 (FKBP1) from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)

KEGG orthology group: K09568, FK506-binding protein 1 [EC: 5.2.1.8] (inferred from 78% identity to tps:THAPSDRAFT_41658)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase"

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>mRNA_4994 K09568 FKBP1 FK506-binding protein 1 (Rhodosporidium toruloides IFO0880)
MGVTVETIRPGDGQNFPKKGDTVTMHYHGTLASNGNKFDSSYDRGQPFQTAIGVGRVIRG
WDEGVPQLSLGQKAKLHITSDYGYGARGAGGVIPPNADLVFEVELLKIN