Protein Info for mRNA_5017 in Rhodosporidium toruloides IFO0880

Name: 13385
Annotation: K08963 mtnA methylthioribose-1-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 56 to 71 (16 residues), see Phobius details TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase" amino acids 14 to 401 (388 residues), 348.3 bits, see alignment E=3.8e-108 TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins" amino acids 37 to 401 (365 residues), 262.8 bits, see alignment E=3.8e-82 PF01008: IF-2B" amino acids 91 to 401 (311 residues), 173.6 bits, see alignment E=2.7e-55

Best Hits

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>mRNA_5017 K08963 mtnA methylthioribose-1-phosphate isomerase (Rhodosporidium toruloides IFO0880)
VLGAFRITGGRSFYDTASVEIIDQLLLPHQEVWEEVSTIEGAFDAIKTMKIRGAPAIASL
ASLGIAAELLNLLNNRPCPSFPASTLSSPPSELLKFLLDRTAYLLTSRPTAVNLREALSR
IEAAAKAEASAEGATAESLARKVIDVAVGVWVEDKERCEKIGNNGAKWILEKLEREGTIQ
KGEKIAVLTVCNTGSLATSGYGTALGVITSLHKQNRLEHAYFAQTGPYQQGARLTAVELA
SLGAPNTMVCDTAIGALLGEKRVHLFVAGADRIASNGDTANKISTYQISLLAHHPHPHSP
NPPVPVLVAAPLTTLDLSMRSGREIEIEQRPSWEACTVRGRVVDPAKIAKGEMVAPAKEG
EKVQVETVLVTPPGTNAWNPAFDVTPAMLIEGIVTEVGVAEKKEGEGEYDLR