Protein Info for mRNA_5017 in Rhodosporidium toruloides IFO0880

Name: 13385
Annotation: K08963 mtnA methylthioribose-1-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase
  • amino acids 14 to 401 (388 residues), 348.3 bits, E=3.8e-108
• TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins
  • amino acids 37 to 401 (365 residues), 262.8 bits, E=3.8e-82
• PF01008: IF-2B
  • amino acids 91 to 401 (311 residues), 173.6 bits, E=2.7e-55

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

• 5'-deoxyadenosine degradation I (2/3 steps found)
• L-methionine salvage cycle III (7/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
• 5'-deoxyadenosine degradation II (1/4 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (3/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (6/12 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Protein Sequence (412 amino acids)

>mRNA_5017 K08963 mtnA methylthioribose-1-phosphate isomerase (Rhodosporidium toruloides IFO0880)
VLGAFRITGGRSFYDTASVEIIDQLLLPHQEVWEEVSTIEGAFDAIKTMKIRGAPAIASL
ASLGIAAELLNLLNNRPCPSFPASTLSSPPSELLKFLLDRTAYLLTSRPTAVNLREALSR
IEAAAKAEASAEGATAESLARKVIDVAVGVWVEDKERCEKIGNNGAKWILEKLEREGTIQ
KGEKIAVLTVCNTGSLATSGYGTALGVITSLHKQNRLEHAYFAQTGPYQQGARLTAVELA
SLGAPNTMVCDTAIGALLGEKRVHLFVAGADRIASNGDTANKISTYQISLLAHHPHPHSP
NPPVPVLVAAPLTTLDLSMRSGREIEIEQRPSWEACTVRGRVVDPAKIAKGEMVAPAKEG
EKVQVETVLVTPPGTNAWNPAFDVTPAMLIEGIVTEVGVAEKKEGEGEYDLR