Protein Info for mRNA_5021 in Rhodosporidium toruloides IFO0880

Name: 13389
Annotation: K14347 SLC10A7, P7 solute carrier family 10 (sodium/bile acid cotransporter), member 7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 85 to 106 (22 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 335 to 360 (26 residues), see Phobius details amino acids 380 to 408 (29 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details PF13593: SBF_like" amino acids 89 to 442 (354 residues), 299.8 bits, see alignment E=2.5e-93 PF01758: SBF" amino acids 125 to 318 (194 residues), 32.2 bits, see alignment E=8.6e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>mRNA_5021 K14347 SLC10A7, P7 solute carrier family 10 (sodium/bile acid cotransporter), member 7 (Rhodosporidium toruloides IFO0880)
MTTLHRSSSPAPSATSTLRSVVSQAELASTSAKRPLEEPSDETLRVEERAQVAELPRDGA
CQEDAVTLPKSGGRVKRGLKAVWDLLRAQWFVLGVGVVIVLAWAFPNVARPGGAIRSEYT
IKYLAVAIIFFISGLTLPLRNLFLRAGDWKLHLVCHITSFFLFPAVTFAIINAVRAADPQ
YKRFDRWALVGMQVMAVLPTTVSSNVVMTGQAGGDEAATTVEVMIGNLFGTFLSPALLSL
FMSSSTWSFGKPVASGKGGIGELYRQVIQQLGFTVFVPLTIGEILQYIWPKQVKWTRTTF
RLGKVGSICLLLVIWSTFSGAFYEGAFEILTGEAVAFVVLVNIGLYLVISLFLFLVCRLI
PSPRLRLKGRKFAYDGSGPLFDAATTIAALFVGGAKGAALGAPIVSILYGGLDGQARGIV
SLPLVLYQGSQVVLGQLAVVILKWWKGRIDRHEAGEDRGTA