Protein Info for mRNA_5023 in Rhodosporidium toruloides IFO0880

Name: 13391
Annotation: K17866 DPH2 diphthamide biosynthesis protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 336 to 356 (21 residues), see Phobius details TIGR00322: diphthamide biosynthesis enzyme Dph1/Dph2 domain" amino acids 39 to 419 (381 residues), 329.2 bits, see alignment E=3e-102 PF01866: Diphthamide_syn" amino acids 61 to 429 (369 residues), 317.3 bits, see alignment E=6.2e-99 TIGR00272: diphthamide biosynthesis protein 2" amino acids 263 to 556 (294 residues), 192.7 bits, see alignment E=1e-60

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>mRNA_5023 K17866 DPH2 diphthamide biosynthesis protein 2 (Rhodosporidium toruloides IFO0880)
MSATQAPPSVAPSGEEAIHRTVDTEPQAFVDSEVPLDEAYEVDLTLREIEKGGYQRIALQ
FADEQLHDAVAVYRALRARLPKEKEFYVLADTTYGSCCVDEVAAQHVDADFVVHYGHTCL
SPTARLPVLYVLTKREIDPDHAASSLASTSRASLEEQPAKAVIVLYDVGYAHKAHLVADA
LRSHLPPSLPVVLSHLDKRANLRSHTHSTGTISESSASPPTTKGKERAPSPPAEPSTDAP
SLAYDDEPSVPPPPMTVPRTSSRYDLPEGVESIEECVLFWIGPESLALNNVLLTHGRCRV
WSYDPTTRQARLESGRTNRMLMRRYATVEKAKDADVIGILVGTLGVAAYLPLITHLRQLI
ASHHKKSYTVAVGKLNPAKLANFIEVECFVLVACPENSMIDSKDFLRPIVTPFELELALT
SKAWTGDYVLDFAQLLESSDFGQDAGTVEVEQEGEDGEAEGEDGEAPVFSAVTGTYRHPK
KYYQRGFKDADDLTAQASALAIRDQSSAVARVLGSAAGEYMSTRTYKGLEPRYGQDAPAV
LELGREGGIARGYGYEKGTDGDEE