Protein Info for mRNA_5056 in Rhodosporidium toruloides IFO0880

Name: 13424
Annotation: K02137 ATPeF0O, ATP5O, ATP5 F-type H+-transporting ATPase subunit O

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF00213: OSCP" amino acids 30 to 208 (179 residues), 147.4 bits, see alignment E=2.4e-47 TIGR01145: ATP synthase F1, delta subunit" amino acids 31 to 208 (178 residues), 102 bits, see alignment E=2.2e-33

Best Hits

Swiss-Prot: 40% identical to ATPO_ASHGO: ATP synthase subunit 5, mitochondrial (ATP5) from Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)

KEGG orthology group: K02137, F-type H+-transporting ATPase oligomycin sensitivity conferral protein [EC: 3.6.3.14] (inferred from 50% identity to uma:UM06324.1)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>mRNA_5056 K02137 ATPeF0O, ATP5O, ATP5 F-type H+-transporting ATPase subunit O (Rhodosporidium toruloides IFO0880)
MFTRRAASTVRTYATQASNSAAPPVQLHGLAGKYASALYTAAAKKNALQQVEADLKGVRS
TIGADAKIHDFLSNPVLSSSDKLAGIDALLKAASPKGASDLTRNLFVVLSENGRLYETDK
VIEGFAELMQAYRGEAKITITSAQPLDKDVQKRLEDALKQSKVASEAKNVVFEYKSNESV
LGGLTVDFGDRTIDLSVASRVSRLNQQLGEGI