Protein Info for mRNA_5064 in Rhodosporidium toruloides IFO0880

Name: 13432
Annotation: K00286 proC pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 75 to 161 (87 residues), 29.3 bits, E=1.1e-10
• TIGR00112: pyrroline-5-carboxylate reductase
  • amino acids 110 to 328 (219 residues), 234.7 bits, E=7e-74
• PF14748: P5CR_dimer
  • amino acids 227 to 329 (103 residues), 126.1 bits, E=6.5e-41

Best Hits

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 62% identity to cnb:CNBF3820)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

• L-arginine degradation VI (arginase 2 pathway) (4/4 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-proline biosynthesis III (from L-ornithine) (3/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Protein Sequence (334 amino acids)

>mRNA_5064 K00286 proC pyrroline-5-carboxylate reductase (Rhodosporidium toruloides IFO0880)
MPYQLCVLGCGTMGVAVLSGVLDNLRAPRSSRQSNGPDESGPSTPMGSLILDNNSNPTSL
PDRCVPTQSFSRALAHASLPCSFIATVNRAESAKKLRRTFFELGGYGPSVEVRQASENVK
SVAESDVILLCCKPQLAAHLLLAPGMSEALEGKLLISILAGTTISMMREWVPSSCTVVRS
MPNTPSKIREGMTVVSSLDPSDAKTPVNREILMALFTPLGKCRFMDEKHFDAVTAVCGSG
PAFVCVVLEAMADGGVMMGLPRSEALELAAQTMQGAARMVLQTGMHPAALKDSVTTPGGC
TIAGLLSLEDARMRSAVARCIQLTAEHAAGLGKK