Protein Info for mRNA_5138 in Rhodosporidium toruloides IFO0880

Name: 13506
Annotation: K20359 RABAC1, PRAF1 PRA1 family protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 54 to 74 (21 residues), see Phobius details amino acids 77 to 93 (17 residues), see Phobius details amino acids 113 to 138 (26 residues), see Phobius details PF03208: PRA1" amino acids 21 to 155 (135 residues), 125 bits, see alignment E=9.2e-41

Best Hits

Swiss-Prot: 41% identical to PRA1_YEAST: Prenylated Rab acceptor 1 (YIP3) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 56% identity to lbc:LACBIDRAFT_189176)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>mRNA_5138 K20359 RABAC1, PRAF1 PRA1 family protein 1 (Rhodosporidium toruloides IFO0880)
MEAQQLMQRLPETLNQFRQERLQTLRPPQEFFNVQRVSKPADMGAATSRIKYNVNYFSGN
YILLILLLAVYSLLTNPLLLIALAFLIGGYIGINRFIPEPVQFGSTTIEPRHLYMVLLIV
GIPILWISAPIASFFWLVGSSSVLILGHAALVEPGVESEYGTVQGV