Protein Info for mRNA_5175 in Rhodosporidium toruloides IFO0880

Name: 13543
Annotation: K08341 GABARAP, ATG8, LC3 GABA(A) receptor-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF02991: Atg8" amino acids 14 to 117 (104 residues), 172.4 bits, see alignment E=2.3e-55 PF04110: APG12" amino acids 40 to 117 (78 residues), 30 bits, see alignment E=5.5e-11

Best Hits

Swiss-Prot: 94% identical to ATG8_EMENI: Autophagy-related protein 8 (atg8) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K08341, GABA(A) receptor-associated protein (autophagy-related protein 8) (inferred from 90% identity to scm:SCHCODRAFT_65747)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>mRNA_5175 K08341 GABARAP, ATG8, LC3 GABA(A) receptor-associated protein (Rhodosporidium toruloides IFO0880)
MVRSKFKDEHVFEKRKAEAERIRAKYSDRIPVICEKAEKTDIPTIDKKKYLVPADLTVGQ
FVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYVTYSGENTFGDA