Protein Info for mRNA_5184 in Rhodosporidium toruloides IFO0880

Name: 13552
Annotation: K03017 RPB9, POLR2I DNA-directed RNA polymerase II subunit RPB9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02150: RNA_POL_M_15KD
  • amino acids 4 to 38 (35 residues), 45.9 bits, E=4.1e-16
• PF01096: TFIIS_C
  • amino acids 73 to 111 (39 residues), 46.1 bits, E=3.6e-16

Best Hits

Swiss-Prot: 52% identical to RPB9_ASHGO: DNA-directed RNA polymerase II subunit RPB9 (RPB9) from Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)

KEGG orthology group: K03017, DNA-directed RNA polymerase II subunit RPB9 (inferred from 61% identity to cnb:CNBI2080)

Predicted SEED Role

"DNA-directed RNA polymerase II 13.2 kDa polypeptide (EC 2.7.7.6)" in subsystem RNA polymerase II (EC 2.7.7.6)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Protein Sequence (127 amino acids)

>mRNA_5184 K03017 RPB9, POLR2I DNA-directed RNA polymerase II subunit RPB9 (Rhodosporidium toruloides IFO0880)
MADIQFCKECSNLLYPKEDKIHHVLLYSCRNCPYQEETHNPCVYKHDLIVVAKETAGVTQ
DLDTDPTLPRSNIECPRCGHHESVFFGDQGRRAQTSMTLFYNCTNCHRTFQDPALLKRRK
EQAAQQA