Protein Info for mRNA_5209 in Rhodosporidium toruloides IFO0880

Name: 13577
Annotation: K03257 EIF4A translation initiation factor 4A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 PF00270: DEAD" amino acids 68 to 231 (164 residues), 149 bits, see alignment E=1.9e-47 PF04851: ResIII" amino acids 82 to 226 (145 residues), 23.4 bits, see alignment E=8.5e-09 PF00271: Helicase_C" amino acids 269 to 377 (109 residues), 106.8 bits, see alignment E=1.2e-34

Best Hits

Swiss-Prot: 82% identical to IF4A_USTMA: ATP-dependent RNA helicase eIF4A (TIF1) from Ustilago maydis (strain 521 / FGSC 9021)

KEGG orthology group: K03257, translation initiation factor 4A (inferred from 89% identity to cci:CC1G_08291)

MetaCyc: 38% identical to ATP-dependent RNA helicase RhlE (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"Eukaryotic translation initiation factor 4A"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>mRNA_5209 K03257 EIF4A translation initiation factor 4A (Rhodosporidium toruloides IFO0880)
MASTTPAATKPETPAAEAPAQAAGGLENPEEGLIESNWDQVVDNFDDMNLRPELLRGIYA
YGFERPSAIQQRAIMPVVAGHDVIAQAQSGTGKTATFSVSILQSIDVNLKQPQALVLAPT
RELAQQIQKVVIALGDYMNIECFAAVGGTSVREAMAKLQEGVHVIVGTPGRVFDMIQRRA
LKTDHIKIFCLDEADEMLSRGFKDQIYDVFQLLPPTTQVVLLSATMPADVLEVTTKFMRD
PIRILVKRDELTLEGIKQFYIAVEKEEWKLETLSDLYETVTITQAVIFCNTRRKVDWLTD
KLQAREFTVSAMHGDMEQAQREVIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLP
SSRENYIHRIGRGGRFGRKGVAINFVTQEDVPALRDIERFYNTQIDEMPMNVADLI