Protein Info for mRNA_5227 in Rhodosporidium toruloides IFO0880

Name: 13595
Annotation: K00601 E2.1.2.2 phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00551: Formyl_trans_N
  • amino acids 43 to 151 (109 residues), 37.9 bits, E=8.2e-14
  • amino acids 198 to 233 (36 residues), 27 bits, 1.8e-10
  • amino acids 271 to 322 (52 residues), 32.1 bits, 5e-12

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (8/12 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.2

Protein Sequence (349 amino acids)

>mRNA_5227 K00601 E2.1.2.2 phosphoribosylglycinamide formyltransferase (Rhodosporidium toruloides IFO0880)
MSQTTPRKWRITVLISGSGKLPFLLLDSLTLTHRSHSLEIPCTGSNLQAILDATQLPASD
PLSLAHCTVTSVFSSRTDAFGLTRARTFAPSPTPAESFPLLRWRKQPGNEGKGRAEWERE
LARKIRDTKPDLVVLAGWMLILGEGFLDELRRDWDEEAAGVSSPPPSPSALPSLDPNSPS
PISHGLTTPGASPYPSSLPSASLRNRPIPIINLHPALPGQFPGAHAIKDAWDAFNTPSSS
TFTSSTSSSSATLETLDPSTNEGEVGGRRITKTGIMIHRVIPLLDAGAPVIVKEVPLVEG
ESLEGLEERIHQVEHVGIVEAVKEVTRLLGEGSWWDEEGVEGGKVVPKA