Protein Info for mRNA_5233 in Rhodosporidium toruloides IFO0880

Name: 13601
Annotation: HMMPfam-Transmembrane amino acid transporter protein-PF01490

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 transmembrane" amino acids 118 to 139 (22 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 398 to 423 (26 residues), see Phobius details amino acids 443 to 463 (21 residues), see Phobius details amino acids 471 to 492 (22 residues), see Phobius details PF01490: Aa_trans" amino acids 131 to 477 (347 residues), 82.9 bits, see alignment E=1e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>mRNA_5233 HMMPfam-Transmembrane amino acid transporter protein-PF01490 (Rhodosporidium toruloides IFO0880)
MDSAALAGVAIPQQEANESEKQMDQFYQPQVGSDKISLAEYRYWAARQRERERNDTADFH
SRGLASFAHTVKGKIGKSEKDHDVHIREATDSPALDDVAADLEGLSERELELVNARRALR
VAGWATIFYLITTDILGPFNAPYAIASMGMASGVVLYVVFGIIAFITGVMLHRLFLHMDS
VRYPIRTFGDLGGRVFGSWMRHLCSILQAIQLILNVGLICLSNGQGVAQIAAGGNGPAIC
FSVAVVIWTILGIIVGQIRSLQGLGILANGSVWLNILIIILSMAFIAHSPPNYASAAATY
GDSIGTGPVVVVARVNQPVFSQVNGLMNMVFAYGGSMIFPELMAEMRRPHDFIRSMALAQ
ALIITCYLVYGIYVYAMQGQYTLPLAYQGVSRYAWQTVTNVIALITGAIAAGLYGNIGLK
VIYINIVEGLLKGPPLMTSRGRVVWSGMVVLFWGLAFVIASAIPSVGTLSGLVAAVHIPV
HLHVPASLHPWLLDFR