Protein Info for mRNA_5267 in Rhodosporidium toruloides IFO0880

Name: 13635
Annotation: KOG2504 Monocarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 331 (306 residues), 50.4 bits, see alignment E=8.5e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>mRNA_5267 KOG2504 Monocarboxylate transporter (Rhodosporidium toruloides IFO0880)
MPSVLVYLQSHDPWQQSSLAALSAIATVLLAVMFMVPILVITVFRRYPDWVKTILWGSAL
VNCLAMLASSWATKVWHLILLQGVVLGLSGAVLYAPVLLWLNSWFHMRRGLASGIVFAGT
GIGGLVFPFIISTLLDRHGFATMCRVWAAITGAVYAVAVWLIRSRVPPTRPKGERGPWFA
TGDASFLKDPVVLMMTATSFVSSLAYFPVSLYLPTYTTSLASPLSANIVVAAFNLSSSIG
STVTGYASDLSVEWTIAVMGVCGAVLALTAWGLASSLGAVFAFAVLFSLFSQTCSCWGAA
ARDSAGANPHLSTLIFCTFGIVRGCASIIGPFISTTLYDSKVAQEHSSWGRYGFRKVIIF
VGVMSFASAFGGAGMKWARAKQRRERVRRGSSSG