Protein Info for mRNA_5275 in Rhodosporidium toruloides IFO0880

Name: 13643
Annotation: K06688 UBE2C, UBC11 ubiquitin-conjugating enzyme E2 C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF00179: UQ_con" amino acids 6 to 126 (121 residues), 140.7 bits, see alignment E=1.3e-45

Best Hits

Swiss-Prot: 58% identical to UBE2C_DICDI: Probable ubiquitin-conjugating enzyme E2 C (ube2c) from Dictyostelium discoideum

KEGG orthology group: K06688, ubiquitin-conjugating enzyme E2 C [EC: 6.3.2.19] (inferred from 62% identity to olu:OSTLU_7340)

MetaCyc: 43% identical to ubiquitin-conjugating enzyme E2D2 (Homo sapiens)
RXN-15556 [EC: 2.3.2.23]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.19

Use Curated BLAST to search for 2.3.2.23 or 6.3.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>mRNA_5275 K06688 UBE2C, UBC11 ubiquitin-conjugating enzyme E2 C (Rhodosporidium toruloides IFO0880)
MSLMMSPPAAGISAFPESDSDLTYWVGRLEGAEGTVYEGHVYAISLRFPPEYPYKAPVVR
FESTCYHPNVDLHGNICLDILKEKWSPALSVSTILVSLQSLLGEPNNASPLNVEAAELWD
DVEAYKVELAKHYQPLPEDE