Protein Info for mRNA_5298 in Rhodosporidium toruloides IFO0880

Name: 13666
Annotation: KOG0758 Mitochondrial carnitine-acylcarnitine carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 44 to 67 (24 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 405 to 424 (20 residues), see Phobius details PF00153: Mito_carr" amino acids 85 to 170 (86 residues), 55.1 bits, see alignment E=3e-19 amino acids 235 to 276 (42 residues), 33.8 bits, see alignment 1.3e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>mRNA_5298 KOG0758 Mitochondrial carnitine-acylcarnitine carrier protein (Rhodosporidium toruloides IFO0880)
MTPSPTPSALSSSPAHTSNPSASSSSSHTKVGLISLYRSEGIRFFFAGTAGPILGLAFID
SAFFGLYGRMMQALHQDRQDPNALSRVFASGATAGALCALLETPIEVVKTRAQVESVPGK
KLGSFRIASQIARKEGLRGFYIGGLMTAVHDGISSGIFFWGYFVFRRMLRGEDPFHAASA
NAQPPPASTIESFAASTASSSSSSSPSSAPAWQSQPQPDTPAPIPSSSPPTLSKTEILRI
LFAGGCAGALSALIPYPFDIVKTRLQTANFESRARSSPVNIGRGGAGFEGRFTSNATPFH
TRVGAKQAAEAVEGIASASGTGAGSGRMTVPSVFRGIHADGVASYRYRYPSTLVYQLLST
WVFPQRGAGAPGKEKTVLDPRAEKWALRVLGFKGFARGLRPTVVSSFVGSAATITTVEIA
LHFLGVSNGGGVG