Protein Info for mRNA_5319 in Rhodosporidium toruloides IFO0880

Name: 13687
Annotation: HMMPfam-Plasma-membrane choline transporter-PF04515

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 transmembrane" amino acids 225 to 244 (20 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 383 to 409 (27 residues), see Phobius details amino acids 419 to 440 (22 residues), see Phobius details amino acids 485 to 507 (23 residues), see Phobius details amino acids 524 to 543 (20 residues), see Phobius details amino acids 581 to 604 (24 residues), see Phobius details amino acids 616 to 631 (16 residues), see Phobius details PF04515: Choline_transpo" amino acids 344 to 650 (307 residues), 135.9 bits, see alignment E=9.4e-44

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (702 amino acids)

>mRNA_5319 HMMPfam-Plasma-membrane choline transporter-PF04515 (Rhodosporidium toruloides IFO0880)
MNFSQFASNLLASSSPATTQPPLFIASRADRHPHARGADEGDVLGLVEDSEVFGARAGGA
KGKERMAGDDDGLEGEIEGSEDDEPPASLVAPRTGSHDARGAVPAFVAKFGITTPGAGGG
GGGRGWKAYESIAASAAAFRHGRGGRADVIYSDGESSDEDEEDDGPLPGAFVSQPGEAQR
EYAMDEPLVGADAAQRRKETLYVYPVPAAEGEEADPARYRDSGWIVAYGLCVLAVVALAI
TAWTSSPLPKSSTSPAIRASTSLLSTALPSLSLLTLISLFAGLTTLAYLLLLSHSLRTLL
TLSILGAPFVFSATGIIAFAGSFPTSGVEADRGWKVGMRVFSVACFVLAFLVGGEAVKRR
KEMDRAINVGELACQTVLSHPPLIVLALALSLTSLAVTIPFLTLIASLLSLSPTHPHLAS
YGTAFTLLVYLWSLAILRGVSHATVGGVVGWWYFEREEEEGGQGLALGPTEVTRAAVARA
TGPSLGTVIAFSFFLSLFTTISTTLSTLSRLLRSSRIPTPLRPITALLAGLFTSIAASTA
FFKSYALSYAGMTGQSWSRSARETASLIRSNRARNIRDTALLRLTLFTTTTTYSLLAGLL
SFLLTSSSLAPSSGGYAPTLAILSYIIPAYTVKLCHDLVGDCVDALWVCVSLEASEGEGA
AVVGGFSRCPKAVEAVSLHFFSGRLGLEVCLVTGSSLSLESS