Protein Info for mRNA_5326 in Rhodosporidium toruloides IFO0880

Name: 13694
Annotation: K00020 mmsB, HIBADH 3-hydroxyisobutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 232 to 253 (22 residues), see Phobius details PF03446: NAD_binding_2" amino acids 18 to 208 (191 residues), 120.4 bits, see alignment E=8.7e-39 PF14833: NAD_binding_11" amino acids 242 to 315 (74 residues), 39.9 bits, see alignment E=4.7e-14

Best Hits

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>mRNA_5326 K00020 mmsB, HIBADH 3-hydroxyisobutyrate dehydrogenase (Rhodosporidium toruloides IFO0880)
MRATVLLRNAYNRSNTAAFIGLGAMGRGMAANLLDKSFAGSQGAWGAEAARKGERGAFVV
YDAFPSALNQFLSSHTNAFAGRDVLPASSPAGATRLASTIVTMLPSSKEVEEVYLGENGI
REALEGMSEEKRRETLLIDCTTGDREEAIRVAREMESLGVKMVDAPVSGGVVGAEKGTLS
FMVGGSEEAFAQAQPFLQKMGARYIHCGASGNGLAVKICNKFVSSLLRFPSTFLIFCAVH
RSLLLGISMIGTAEAMLLGKSLGLSSELLATVINTSTGRCWSSETNNPAPKATPTIPTPA
DRGYTGGFLSKLMSKGASSPSLPLPSLDYLLTPRLDADLNLALTSATRSGVPLPLGQLSG
TLYQKLSAHEEFAGRDFSVVYRYLEEAMEGGFGERSGKKGKGE