Protein Info for mRNA_5329 in Rhodosporidium toruloides IFO0880

Name: 13697
Annotation: K02212 MCM4, CDC54 DNA replication licensing factor MCM4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 PF14551: MCM_N" amino acids 25 to 105 (81 residues), 26.4 bits, see alignment E=3.1e-09 PF17207: MCM_OB" amino acids 144 to 272 (129 residues), 132.3 bits, see alignment E=3.3e-42 PF00493: MCM" amino acids 335 to 560 (226 residues), 328.7 bits, see alignment E=4.8e-102 PF07728: AAA_5" amino acids 396 to 515 (120 residues), 33.6 bits, see alignment E=1.3e-11 PF01078: Mg_chelatase" amino acids 450 to 512 (63 residues), 22.4 bits, see alignment E=2.5e-08 PF17855: MCM_lid" amino acids 578 to 664 (87 residues), 96 bits, see alignment E=5.3e-31

Best Hits

KEGG orthology group: K02212, minichromosome maintenance protein 4 (cell division control protein 54) (inferred from 68% identity to lbc:LACBIDRAFT_248146)

Predicted SEED Role

"DNA replication helicase protein MCM" in subsystem DNA replication, archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (771 amino acids)

>mRNA_5329 K02212 MCM4, CDC54 DNA replication licensing factor MCM4 (Rhodosporidium toruloides IFO0880)
MLRGQLSKVPLDSDIEFAYAKEPPHKKLYQSYLERMRDTGQTNLNLDVVDLLAFRWRETQ
AREGGARTREDREYAQLYRNFLLYPQELVPILDQQLKDSALEWACAEENLGEGPMRLENE
QRAREMHGAVFKVRPYAGETKVNMRDLNPQDIDKIVCIKGLVIRATPIIPDMKLAFFRCN
ACSHTVTVEIDRGKIAEPDRCPRDVCNVQGSMLLVHNRCEFADRQIVRLQETPDSVPDGQ
TPHTVSLGLYDELVDTVKPGDRVTVTGIFRSVPVRLNPRQRVIKSLFKTYIDVLHVKKTD
KRRMGVDGSTRSADDRRGVVGVDERRASTHARLKEKLVEISRRPDIYDYLARSLAPSIYE
MDDVKKGILLQLFGGTNKSIAKGGGAGGPRYRGDINVLLVGDPGTSKSQILQYVHKIAPR
GVYTSGKGSSAVGLTAYVTRDPDSKQLVLESGALVLSDGGVCCIDEFDKMSDATRSVLHE
VMEQQTVSIAKAGIITTLNARTSILAAANPVGSKYNLKWPITRNIDLPPTLISRFDLLYL
VLDKIDERSDRQLAKFLVGLYLEDKPQTAGTDIMNIEDLTAYISWARNHIHPELTPEASN
ALVQAYVEMRNAGADARSNDRRITATTRQLESMIRLSEAHARMRYSEKVEVEDVTEANRL
IREALKESATDPLTGLIDLDLLGGQSTHQRKLRGDLRRELVVLLSTPTASSKGLKYADLV
RQLEAQSSVSIDVQELSEVIKSLESEGSVRVSGQGNARIVKLIGGAQQVEM