Protein Info for mRNA_5337 in Rhodosporidium toruloides IFO0880

Name: 13705
Annotation: HMMPfam-Fungal Zn(2)-Cys(6) binuclear cluster domain-PF00172,HMMPfam-Fungal specific transcription factor domain-PF04082,ProSitePatterns-Zn(2)-C6 fungal-type DNA-binding domain signature.-PS00463,ProSiteProfiles-Zn(2)-C6 fungal-type DNA-binding domain profile.-PS50048,SMART-GAL4-like Zn(II)2Cys6 (or C6 zinc) binuclear cluster DNA-binding domain-SM00066,SMART-Fungal specific transcription factor domain-SM00906,SUPERFAMILY--SSF57701

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 929 transmembrane" amino acids 323 to 340 (18 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details amino acids 432 to 450 (19 residues), see Phobius details amino acids 513 to 531 (19 residues), see Phobius details PF00172: Zn_clus" amino acids 17 to 61 (45 residues), 25.8 bits, see alignment 9.8e-10 PF04082: Fungal_trans" amino acids 282 to 469 (188 residues), 41.4 bits, see alignment E=9.2e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (929 amino acids)

>mRNA_5337 HMMPfam-Fungal Zn(2)-Cys(6) binuclear cluster domain-PF00172,HMMPfam-Fungal specific transcription factor domain-PF04082,ProSitePatterns-Zn(2)-C6 fungal-type DNA-binding domain signature.-PS00463,ProSiteProfiles-Zn(2)-C6 fungal-type DNA-binding domain profile.-PS50048,SMART-GAL4-like Zn(II)2Cys6 (or C6 zinc) binuclear cluster DNA-binding domain-SM00066,SMART-Fungal specific transcription factor domain-SM00906,SUPERFAMILY--SSF57701 (Rhodosporidium toruloides IFO0880)
MESDGDGQPQKKRRVTRACDQCRRKRIKCDSYPRAAIDSPCVICTEAGQADQCTYSRPAK
KRGPQAGRARTLEEKCAVFERLMGYLLAAVPNLEAHVSHFIAQAQGGATSPSSSTPGDDS
PAASTSSAISPAALAAQHQQRYTSSRIAELLESVLPPPISAREAAKQGKRESSSAAKDED
LASGLASIKYPSPAASLPLPPVAGFPYPPAFPQPAELPDPFSYGAHAGPSSFPLALQTLA
EAAVPDAAASAFASGGGKGKGREVLVMEDPALPDGVARSALLDLYFNQVVQPVLPMLDKS
RFLRWSAHLPASQPSTSSSTSLIPPSLYYAVFALASSYISPSSPFASSLPPNATETYARA
ARTHLVRDVFLDGTGGLSVENVQSAAILALVDWGAGQLDRAWMMSALALSLALSLSLHLS
TALAPDPSSYKLKTFHSILIIHVLLSLRLGRPPLTVLEDYDVPIPPVDDEAINWDLWRSD
KSAAELRAEWGDTDSASDGTDGGPVTAVRNNSLVTFARLASLCAIALNVLRWNVCPRRGN
GQGLPAGEAERAELVASLGAWEEQLEMDLRLGDARGGVELVRERARWIVEMHLVAAALHL
KLRPHPSFASVAVDPIPRSLGLLNHVLGRYRSTFTLYRSLPSIDLVLHLFSETLFDQSDY
APHHHDTVLRAYAELAKVFPVAQKSWVELAAKVDGHKRELGLLRGVHPTTSIQPPPPALP
APAPIAEPFQAFLSYSNDLGPSANPSTILDFGSWDQSDLLVSLGLVGPAAGSKGTWTPLE
GWGGPEGGMPVPMPIEGAVGYGEISHQHGQSLAPQPATLPPPPAKQPAGAGASSSFPMVI
SPASTAPTGDSTAYGETSFAGLPYNIPSPSGGQVDTSASTFPYQSFAAANTPSSSDSGGP
ATDLLTRWIDRGSLGFGGAFEAVGEGGAG