Protein Info for mRNA_5361 in Rhodosporidium toruloides IFO0880

Name: 13729
Annotation: K00511 SQLE, ERG1 squalene monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 418 to 435 (18 residues), see Phobius details amino acids 475 to 492 (18 residues), see Phobius details amino acids 516 to 536 (21 residues), see Phobius details PF01494: FAD_binding_3" amino acids 24 to 380 (357 residues), 34.1 bits, see alignment E=2.9e-12 PF08491: SE" amino acids 193 to 494 (302 residues), 296.6 bits, see alignment E=2.3e-92

Best Hits

Predicted SEED Role

"Squalene monooxygenase (EC 1.14.13.132)" (EC 1.14.13.132)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.132

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>mRNA_5361 K00511 SQLE, ERG1 squalene monooxygenase (Rhodosporidium toruloides IFO0880)
MIQTHADATRVPSADPQSAAATEFDIAIVGAGILGPALAYGLAESGRSVLLLERDLSEPD
RIVGELLQPGGCLALQKLGIDDALEGIDAVPCGGYQVFWGDQSVAIPYPEESKKMIWSDG
TERKQEGRSFHHGHFVQNLRRKAQSAKGVTLVEATVNELIEDAAGTIVGIKATPRKRDTD
DATSDPVQLDFRAKLTIVADGCMSKFRRSLLPSHVTPSTRSHFVGLVLEDADLPAPHHGH
VILGKMDPANPPPPADLNVPSLGPVLVYQLATHETRMLVDVRGHKLPPQRDLASFLRTHV
TPVLPSSIVPSFEKALEKSLSGDKAYRLRSMPNSWLPSYPQGRDVQGAFLAGDSLNMRHP
LTGGGMTVAFNDAVILTQLLGGGKAVGQVEPDERGVVDLENWLDMSERLEEWHWKRKAVA
SCINVLSLALYSLFGADDENLEVLKTGCFKYFERGGDCISGPVSLLSALRPSPALLFYHF
FRVAFYSIYCLFTTPTRSSTSSTPAEKPAVWDYPALTAKSIRVFWTACVVLLPVLWSEGQ
M